SCOPe 2.08: Domain d4cqwe1: 4cqw E:1-320

Lineage for d4cqwe1 (4cqw E:1-320)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.19: Viral protein domain [49817] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll; form trimers

4. Superfamily b.19.1: Viral protein domain [49818] (4 families)
   forms homotrimers

5. Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)

6. Protein automated matches [190291] (19 species)
   not a true protein

7. Species Influenza A virus (a/turkey/turkey/1/2005(h5n1)) [TaxId:375457] [193032] (5 PDB entries)

8. Domain d4cqwe1: 4cqw E:1-320 [266064]
   Other proteins in same PDB: d4cqwa2, d4cqwb_, d4cqwc2, d4cqwd_, d4cqwe2, d4cqwf_
   automated match to d1rd8a_
   complexed with nag, po4; mutant

Details for d4cqwe1

PDB Entry: 4cqw, 2.3 Å

PDB Description: h5 (tyty) del133/ile155thr mutant haemagglutinin in complex with avian receptor analogue 3'sln

PDB Compounds: (E:) haemagglutinin ha1

SCOPe Domain Sequences for d4cqwe1:

Sequence; same for both SEQRES and ATOM records:

>d4cqwe1 b.19.1.2 (E:1-320) automated matches {Influenza A virus (a/turkey/turkey/1/2005(h5n1)) [TaxId: 375457]}
dqicigyhannsteqvdtimeknvtvthaqdilekthngklcdldgvkplilrdcsvagw
llgnpmcdeflnvpewsyivekinpandlcypgnfndyeelkhllsrinhfekiqiipks
swsdheasgvssacpyqgrssffrnvvwltkkdnayptikrsynntnqedllvlwgihhp
ndaaeqtrlyqnpttyisvgtstlnqrlvpkiatrskvngqsgrmeffwtilkpndainf
esngnfiapenaykivkkgdstimkseleygncntkcqtpigainssmpfhnihpltige
cpkyvkssrlvlatglrnsp

Timeline for d4cqwe1:

• d4cqwe1 first appeared in SCOPe 2.05, called d4cqwe_
  
• d4cqwe1 appears in SCOPe 2.07