SCOPe 2.05: Domain d4cqwd_: 4cqw D:

Lineage for d4cqwd_ (4cqw D:)

1. Root: SCOPe 2.05

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
   core: trimeric coiled coil

4. Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families)

5. Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)

6. Protein automated matches [254646] (33 species)
   not a true protein

7. Species Influenza a virus (a/turkey/turkey/1/2005(h5n1)) [TaxId:375457] [256678] (4 PDB entries)

8. Domain d4cqwd_: 4cqw D: [266063]
   Other proteins in same PDB: d4cqwa_, d4cqwc_, d4cqwe_
   automated match to d2fk0b1
   complexed with nag, po4; mutant

Details for d4cqwd_

PDB Entry: 4cqw, 2.3 Å

PDB Description: h5 (tyty) del133/ile155thr mutant haemagglutinin in complex with avian receptor analogue 3'sln

PDB Compounds: (D:) haemagglutinin ha2

SCOPe Domain Sequences for d4cqwd_:

Sequence; same for both SEQRES and ATOM records:

>d4cqwd_ h.3.1.1 (D:) automated matches {Influenza a virus (a/turkey/turkey/1/2005(h5n1)) [TaxId: 375457]}
glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
kvrlqlrdnakelgngcfefyhrcdnecmesvrngtydypqys

Timeline for d4cqwd_:

• d4cqwd_ is new in SCOPe 2.05-stable
  
• d4cqwd_ appears in SCOPe 2.06
  
• d4cqwd_ appears in the current release, SCOPe 2.08