Lineage for d4cqwc_ (4cqw C:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1778087Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 1778088Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 1778135Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)
  6. 1778497Protein automated matches [190291] (24 species)
    not a true protein
  7. 1778547Species Influenza a virus (a/turkey/turkey/1/2005(h5n1)) [TaxId:375457] [256675] (4 PDB entries)
  8. 1778555Domain d4cqwc_: 4cqw C: [266062]
    Other proteins in same PDB: d4cqwb_, d4cqwd_, d4cqwf_
    automated match to d1rd8a_
    complexed with nag, po4; mutant

Details for d4cqwc_

PDB Entry: 4cqw (more details), 2.3 Å

PDB Description: h5 (tyty) del133/ile155thr mutant haemagglutinin in complex with avian receptor analogue 3'sln
PDB Compounds: (C:) haemagglutinin ha1

SCOPe Domain Sequences for d4cqwc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4cqwc_ b.19.1.2 (C:) automated matches {Influenza a virus (a/turkey/turkey/1/2005(h5n1)) [TaxId: 375457]}
dpdqicigyhannsteqvdtimeknvtvthaqdilekthngklcdldgvkplilrdcsva
gwllgnpmcdeflnvpewsyivekinpandlcypgnfndyeelkhllsrinhfekiqiip
ksswsdheasgvssacpyqgrssffrnvvwltkkdnayptikrsynntnqedllvlwgih
hpndaaeqtrlyqnpttyisvgtstlnqrlvpkiatrskvngqsgrmeffwtilkpndai
nfesngnfiapenaykivkkgdstimkseleygncntkcqtpigainssmpfhnihplti
gecpkyvkssrlvlatglrnsp

SCOPe Domain Coordinates for d4cqwc_:

Click to download the PDB-style file with coordinates for d4cqwc_.
(The format of our PDB-style files is described here.)

Timeline for d4cqwc_: