Class b: All beta proteins [48724] (180 folds) |
Fold b.19: Viral protein domain [49817] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll; form trimers |
Superfamily b.19.1: Viral protein domain [49818] (4 families) forms homotrimers |
Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins) |
Protein automated matches [190291] (19 species) not a true protein |
Species Influenza A virus (a/turkey/turkey/1/2005(h5n1)) [TaxId:375457] [193032] (5 PDB entries) |
Domain d4cqwc1: 4cqw C:1-320 [266062] Other proteins in same PDB: d4cqwa2, d4cqwb_, d4cqwc2, d4cqwd_, d4cqwe2, d4cqwf_ automated match to d1rd8a_ complexed with nag, po4; mutant |
PDB Entry: 4cqw (more details), 2.3 Å
SCOPe Domain Sequences for d4cqwc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4cqwc1 b.19.1.2 (C:1-320) automated matches {Influenza A virus (a/turkey/turkey/1/2005(h5n1)) [TaxId: 375457]} dqicigyhannsteqvdtimeknvtvthaqdilekthngklcdldgvkplilrdcsvagw llgnpmcdeflnvpewsyivekinpandlcypgnfndyeelkhllsrinhfekiqiipks swsdheasgvssacpyqgrssffrnvvwltkkdnayptikrsynntnqedllvlwgihhp ndaaeqtrlyqnpttyisvgtstlnqrlvpkiatrskvngqsgrmeffwtilkpndainf esngnfiapenaykivkkgdstimkseleygncntkcqtpigainssmpfhnihpltige cpkyvkssrlvlatglrnsp
Timeline for d4cqwc1: