| Class h: Coiled coil proteins [57942] (7 folds) |
| Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies) core: trimeric coiled coil |
Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) ![]() |
| Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins) |
| Protein automated matches [254646] (29 species) not a true protein |
| Species Influenza A virus (a/turkey/turkey/1/2005(h5n1)) [TaxId:375457] [256202] (5 PDB entries) |
| Domain d4cqwb_: 4cqw B: [266061] Other proteins in same PDB: d4cqwa1, d4cqwa2, d4cqwc1, d4cqwc2, d4cqwe1, d4cqwe2 automated match to d2fk0b1 complexed with nag, po4; mutant |
PDB Entry: 4cqw (more details), 2.3 Å
SCOPe Domain Sequences for d4cqwb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4cqwb_ h.3.1.1 (B:) automated matches {Influenza A virus (a/turkey/turkey/1/2005(h5n1)) [TaxId: 375457]}
glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
kvrlqlrdnakelgngcfefyhrcdnecmesvrngtydypqys
Timeline for d4cqwb_: