![]() | Class h: Coiled coil proteins [57942] (7 folds) |
![]() | Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies) core: trimeric coiled coil |
![]() | Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) ![]() |
![]() | Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins) |
![]() | Protein Influenza hemagglutinin (stalk) [58066] (22 species) trimer |
![]() | Species Influenza A virus (a/vietnam/1194/2004(h5n1)) [TaxId:644788] [419797] (7 PDB entries) |
![]() | Domain d4cqub_: 4cqu B: [266059] Other proteins in same PDB: d4cqua_ automated match to d2fk0b1 complexed with mpo, nag; mutant |
PDB Entry: 4cqu (more details), 2.48 Å
SCOPe Domain Sequences for d4cqub_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4cqub_ h.3.1.1 (B:) Influenza hemagglutinin (stalk) {Influenza A virus (a/vietnam/1194/2004(h5n1)) [TaxId: 644788]} glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd kvrlqlrdnakelgngcfefyhkcdnecmesvrngtydypqy
Timeline for d4cqub_: