SCOPe 2.05: Domain d4cqtb_: 4cqt B:

Lineage for d4cqtb_ (4cqt B:)

1. Root: SCOPe 2.05

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
   core: trimeric coiled coil

4. Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families)

5. Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)

6. Protein automated matches [254646] (33 species)
   not a true protein

7. Species Influenza a virus (a/vietnam/1194/2004(h5n1)) [TaxId:644788] [256672] (9 PDB entries)

8. Domain d4cqtb_: 4cqt B: [266057]
   Other proteins in same PDB: d4cqta_
   automated match to d2fk0b1
   complexed with mpo, nag; mutant

Details for d4cqtb_

PDB Entry: 4cqt, 2.55 Å

PDB Description: h5 (vn1194) asn186lys mutant haemagglutinin in complex with avian receptor analogue 3'sln

PDB Compounds: (B:) haemagglutinin ha2

SCOPe Domain Sequences for d4cqtb_:

Sequence; same for both SEQRES and ATOM records:

>d4cqtb_ h.3.1.1 (B:) automated matches {Influenza a virus (a/vietnam/1194/2004(h5n1)) [TaxId: 644788]}
glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
kvrlqlrdnakelgngcfefyhkcdnecmesvrngtydypqy

Timeline for d4cqtb_:

• d4cqtb_ is new in SCOPe 2.05-stable
  
• d4cqtb_ does not appear in SCOPe 2.06