Lineage for d4cqrb_ (4cqr B:)

  1. Root: SCOPe 2.06
  2. 2265466Class h: Coiled coil proteins [57942] (7 folds)
  3. 2266922Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 2266923Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 2266924Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 2267375Protein automated matches [254646] (34 species)
    not a true protein
  7. 2267442Species Influenza a virus (a/vietnam/1194/2004(h5n1)) [TaxId:644788] [256672] (8 PDB entries)
  8. 2267443Domain d4cqrb_: 4cqr B: [266055]
    Other proteins in same PDB: d4cqra_
    automated match to d2fk0b1
    complexed with mpo, nag; mutant

Details for d4cqrb_

PDB Entry: 4cqr (more details), 2.45 Å

PDB Description: h5 (vn1194) ser227asn/gln196arg mutant haemagglutinin in complex with human receptor analogue 6'sln
PDB Compounds: (B:) haemagglutinin ha2

SCOPe Domain Sequences for d4cqrb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4cqrb_ h.3.1.1 (B:) automated matches {Influenza a virus (a/vietnam/1194/2004(h5n1)) [TaxId: 644788]}
glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
kvrlqlrdnakelgngcfefyhkcdnecmesvrngtydypqy

SCOPe Domain Coordinates for d4cqrb_:

Click to download the PDB-style file with coordinates for d4cqrb_.
(The format of our PDB-style files is described here.)

Timeline for d4cqrb_: