Lineage for d4cqqb_ (4cqq B:)

  1. Root: SCOPe 2.07
  2. 2643820Class h: Coiled coil proteins [57942] (7 folds)
  3. 2645404Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 2645405Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 2645406Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 2645931Protein automated matches [254646] (36 species)
    not a true protein
  7. 2646047Species Influenza A virus (a/vietnam/1194/2004(h5n1)) [TaxId:644788] [256161] (12 PDB entries)
  8. 2646050Domain d4cqqb_: 4cqq B: [266053]
    Other proteins in same PDB: d4cqqa_
    automated match to d2fk0b1
    complexed with mpo, nag; mutant

Details for d4cqqb_

PDB Entry: 4cqq (more details), 2.55 Å

PDB Description: h5 (vn1194) ser227asn/gln196arg mutant haemagglutinin in complex with avian receptor analogue 3'sln
PDB Compounds: (B:) haemagglutinin ha2

SCOPe Domain Sequences for d4cqqb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4cqqb_ h.3.1.1 (B:) automated matches {Influenza A virus (a/vietnam/1194/2004(h5n1)) [TaxId: 644788]}
glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
kvrlqlrdnakelgngcfefyhkcdnecmesvrngtydypqy

SCOPe Domain Coordinates for d4cqqb_:

Click to download the PDB-style file with coordinates for d4cqqb_.
(The format of our PDB-style files is described here.)

Timeline for d4cqqb_: