SCOPe 2.05: Domain d4cqqa_: 4cqq A:

Lineage for d4cqqa_ (4cqq A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.19: Viral protein domain [49817] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll; form trimers

4. Superfamily b.19.1: Viral protein domain [49818] (4 families)
   forms homotrimers

5. Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)

6. Protein automated matches [190291] (24 species)
   not a true protein

7. Species Influenza a virus (a/vietnam/1194/2004(h5n1)) [TaxId:644788] [228150] (10 PDB entries)

8. Domain d4cqqa_: 4cqq A: [266052]
   Other proteins in same PDB: d4cqqb_
   automated match to d1rd8a_
   complexed with mpo, nag; mutant

Details for d4cqqa_

PDB Entry: 4cqq, 2.55 Å

PDB Description: h5 (vn1194) ser227asn/gln196arg mutant haemagglutinin in complex with avian receptor analogue 3'sln

PDB Compounds: (A:) haemagglutinin ha1

SCOPe Domain Sequences for d4cqqa_:

Sequence; same for both SEQRES and ATOM records:

>d4cqqa_ b.19.1.2 (A:) automated matches {Influenza a virus (a/vietnam/1194/2004(h5n1)) [TaxId: 644788]}
dqicigyhannsteqvdtimeknvtvthaqdilekthngklcdldgvkplilrdcsvagw
llgnpmcdefinvpewsyivekanpvndlcypgdfndyeelkhllsrinhfekiqiipks
swssheaslgvssacpyqgkssffrnvvwlikknstyptikrsynntnqedllvlwgihh
pndaaeqtklyrnpttyisvgtstlnqrlvpriatrskvngqngrmeffwtilkpndain
fesngnfiapeyaykivkkgdstimkseleygncntkcqtpmgainssmpfhnihpltig
ecpkyvksnrlvlatglrnsp

Timeline for d4cqqa_:

• d4cqqa_ is new in SCOPe 2.05-stable
  
• d4cqqa_ appears in SCOPe 2.06
  
• d4cqqa_ appears in the current release, SCOPe 2.08