Class b: All beta proteins [48724] (176 folds) |
Fold b.19: Viral protein domain [49817] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll; form trimers |
Superfamily b.19.1: Viral protein domain [49818] (4 families) forms homotrimers |
Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins) |
Protein automated matches [190291] (24 species) not a true protein |
Species Influenza a virus (a/vietnam/1194/2004(h5n1)) [TaxId:644788] [228150] (10 PDB entries) |
Domain d4cqqa_: 4cqq A: [266052] Other proteins in same PDB: d4cqqb_ automated match to d1rd8a_ complexed with mpo, nag; mutant |
PDB Entry: 4cqq (more details), 2.55 Å
SCOPe Domain Sequences for d4cqqa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4cqqa_ b.19.1.2 (A:) automated matches {Influenza a virus (a/vietnam/1194/2004(h5n1)) [TaxId: 644788]} dqicigyhannsteqvdtimeknvtvthaqdilekthngklcdldgvkplilrdcsvagw llgnpmcdefinvpewsyivekanpvndlcypgdfndyeelkhllsrinhfekiqiipks swssheaslgvssacpyqgkssffrnvvwlikknstyptikrsynntnqedllvlwgihh pndaaeqtklyrnpttyisvgtstlnqrlvpriatrskvngqngrmeffwtilkpndain fesngnfiapeyaykivkkgdstimkseleygncntkcqtpmgainssmpfhnihpltig ecpkyvksnrlvlatglrnsp
Timeline for d4cqqa_: