Lineage for d4cqlo_ (4cql O:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2845793Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2845794Protein automated matches [190069] (319 species)
    not a true protein
  7. 2847056Species Human (Homo sapiens) [TaxId:9606] [186944] (65 PDB entries)
  8. 2847227Domain d4cqlo_: 4cql O: [266050]
    Other proteins in same PDB: d4cqlb2, d4cqlf2, d4cqlj2, d4cqln2
    automated match to d4cqmb_
    complexed with nad

Details for d4cqlo_

PDB Entry: 4cql (more details), 2.85 Å

PDB Description: Crystal structure of heterotetrameric human ketoacyl reductase complexed with NAD
PDB Compounds: (O:) carbonyl reductase family member 4

SCOPe Domain Sequences for d4cqlo_:

Sequence, based on SEQRES records: (download)

>d4cqlo_ c.2.1.0 (O:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mdkvcavfggsrgigravaqlmarkgyrlaviarnlegakaaagdlggdhlafscdvake
hdvqntfeelekhlgrvnflvnaaginrdgllvrtktedmvsqlhtnllgsmltckaamr
tmiqqqggsivnvgsivglkgnsgqsvysaskgglvgfsralakevarkkirvnvvapgf
vhtdmtkdlkeehlkkniplgrfgetievahavvfllespyitghvlvvdgglqlil

Sequence, based on observed residues (ATOM records): (download)

>d4cqlo_ c.2.1.0 (O:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mdkvcavfggsrgigravaqlmarkglaviarnlegakaaagdlggfscdvakehdvqnt
feelekhlgrvnflvnaaginrgllvrtktedmvsqlhtnllgsmltckaamrtmiqqqg
gsivnvgsivglkgnsgqsvysaskgglvgfsralakevarkkirvnvvapgfvhtkeeh
lkkniplgrfgetievahavvfllespyitghvlvvdgglqlil

SCOPe Domain Coordinates for d4cqlo_:

Click to download the PDB-style file with coordinates for d4cqlo_.
(The format of our PDB-style files is described here.)

Timeline for d4cqlo_: