Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
Protein automated matches [190069] (239 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [186944] (46 PDB entries) |
Domain d4cqll_: 4cql L: [266047] Other proteins in same PDB: d4cqlb2, d4cqlf2, d4cqlj2, d4cqln2 automated match to d4cqmh_ complexed with nad |
PDB Entry: 4cql (more details), 2.85 Å
SCOPe Domain Sequences for d4cqll_:
Sequence, based on SEQRES records: (download)
>d4cqll_ c.2.1.0 (L:) automated matches {Human (Homo sapiens) [TaxId: 9606]} lqnrlrsalalvtgagsgigravsvrlagegatvaacdldraaaqetvrllggpgskegp prgnhaafqadvsearaarclleqvqacfsrppsvvvscagitqdefllhmseddwdkvi avnlkgtflvtqaaaqalvsngcrgsiinissivgkvgnvgqtnyaaskagvigltqtaa relgrhgircnsvlpgfiatpmtqkvpqkvvdkitemipmghlgdpedvadvvaflased sgyitgtsvevtgglfm
>d4cqll_ c.2.1.0 (L:) automated matches {Human (Homo sapiens) [TaxId: 9606]} lqnrlrsalalvtgagsgigravsvrlagegatvaacdldraaaqetvrllnhaafqadv searaarclleqvqacfsrppsvvvscagitqdefllhmseddwdkviavnlkgtflvtq aaaqalvsngcrgsiinissivgkvgnvgqtnyaaskagvigltqtaarelgrhgircns vlpgfiatpmtqvvdkitemipmghlgdpedvadvvaflasedsgyitgtsvevtgglfm
Timeline for d4cqll_: