SCOPe 2.08: Domain d4cqlk_: 4cql K:

Lineage for d4cqlk_ (4cql K:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (319 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186944] (65 PDB entries)

8. Domain d4cqlk_: 4cql K: [266046]
   Other proteins in same PDB: d4cqlb2, d4cqlf2, d4cqlj2, d4cqln2
   automated match to d4cqmb_
   complexed with nad

Details for d4cqlk_

PDB Entry: 4cql, 2.85 Å

PDB Description: Crystal structure of heterotetrameric human ketoacyl reductase complexed with NAD

PDB Compounds: (K:) carbonyl reductase family member 4

SCOPe Domain Sequences for d4cqlk_:

Sequence, based on SEQRES records:

>d4cqlk_ c.2.1.0 (K:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kvcavfggsrgigravaqlmarkgyrlaviarnlegakaaagdlggdhlafscdvakehd
vqntfeelekhlgrvnflvnaaginrdgllvrtktedmvsqlhtnllgsmltckaamrtm
iqqqggsivnvgsivglkgnsgqsvysaskgglvgfsralakevarkkirvnvvapgfvh
tdmtkdlkeehlkkniplgrfgetievahavvfllespyitghvlvvdgglqlil

Sequence, based on observed residues (ATOM records):

>d4cqlk_ c.2.1.0 (K:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kvcavfggsrgigravaqlmarkgyrlaviarnlegakaaagdlggafscdvakehdvqn
tfeelekhlgrvnflvnaaginrdgllvrtktedmvsqlhtnllgsmltckaamrtmiqg
sivnvgsivglkgnsgqsvysaskgglvgfsralakevarkkirvnvvapgfvhtdmkkn
iplgrfgetievahavvfllespyitghvlvvdgglqlil

Timeline for d4cqlk_:

• d4cqlk_ first appeared in SCOPe 2.05
  
• d4cqlk_ appears in SCOPe 2.07