Lineage for d4cqab_ (4cqa B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2080000Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) (S)
  5. 2080001Family c.1.4.1: FMN-linked oxidoreductases [51396] (19 protein domains)
  6. 2080389Protein automated matches [190228] (18 species)
    not a true protein
  7. 2080446Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [256645] (7 PDB entries)
  8. 2080453Domain d4cqab_: 4cqa B: [266035]
    automated match to d4cq8a_
    complexed with fmn, id6, oro

Details for d4cqab_

PDB Entry: 4cqa (more details), 2.82 Å

PDB Description: Plasmodium falciparum dihydroorotate dehydrogenase (DHODH) in complex with IDI-6273
PDB Compounds: (B:) dihydroorotate dehydrogenase

SCOPe Domain Sequences for d4cqab_:

Sequence, based on SEQRES records: (download)

>d4cqab_ c.1.4.1 (B:) automated matches {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
fflydiflkfclkyidgeichdlflllgkynilpydtsndsiyactnikhldfinpfgva
agfdkngvcidsilklgfsfieigtitprgqtgnakprifrdvesrsiinscgfnnmgcd
kvtenlilfrkrqeedkllskhivgvsigknkdtvnivddlkycinkigryadyiainvs
spntpglrdnqeagklkniilsvkeeidnleknnimndeflwfnttkkkplvfvklapdl
nqeqkkeiadvlletnidgmiisntttqindiksfenkkggvsgaklkdistkficemyn
ytnkqipiiasggifsgldalekieagasvcqlysclvfngmksavqikrelnhllyqrg
yynlkeaigrkhs

Sequence, based on observed residues (ATOM records): (download)

>d4cqab_ c.1.4.1 (B:) automated matches {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
fflydiflkfclkyidgeichdlflllgkynilpydtsndsiyactnikhldfinpfgva
agfdkngvcidsilklgfsfieigtitprgqtgnakprifrdvesrsiinscgfnnmgcd
kvtenlilfrkrqeedkllskhivgvsigknkdtvnivddlkycinkigryadyiainvs
spntpglrdnqeagklkniilsvkeeidnleknnflwfnttkkkplvfvklapdlnqeqk
keiadvlletnidgmiisntttqindiksfenkkggvsgaklkdistkficemynytnkq
ipiiasggifsgldalekieagasvcqlysclvfngmksavqikrelnhllyqrgyynlk
eaigrkhs

SCOPe Domain Coordinates for d4cqab_:

Click to download the PDB-style file with coordinates for d4cqab_.
(The format of our PDB-style files is described here.)

Timeline for d4cqab_: