Lineage for d4cpzg_ (4cpz G:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2074740Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 2074741Superfamily b.68.1: Sialidases [50939] (3 families) (S)
  5. 2074742Family b.68.1.1: Sialidases (neuraminidases) [50940] (10 proteins)
  6. 2075035Protein automated matches [193245] (14 species)
    not a true protein
  7. 2075120Species Influenza B virus [TaxId:11520] [256642] (3 PDB entries)
  8. 2075131Domain d4cpzg_: 4cpz G: [266026]
    automated match to d1infa_
    complexed with ca, edo, nag, zmr

Details for d4cpzg_

PDB Entry: 4cpz (more details), 2.2 Å

PDB Description: structure of the neuraminidase from the b/lyon/chu/15.216/2011 virus in complex with zanamivir
PDB Compounds: (G:) Neuraminidase

SCOPe Domain Sequences for d4cpzg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4cpzg_ b.68.1.1 (G:) automated matches {Influenza B virus [TaxId: 11520]}
epewtyprlscpgstfqkallisphrfgetkgnsapliirepfiacgpneckhfalthya
aqpggyyngtrgdrnklrhlisvklgkiptvensifhmaawsgsachdgkewtyigvdgp
dndallkvkygeaytdtyhsyankllrtqesacnciggncylmitdgsasgvsecrflki
regriikeifptgrvkhteectcgfasnktiecacrdnsytakrpfvklnvetdtaeirl
mctdtyldtprpddgsitgpcesngdkgsggikggfvhqrmeskigrwysrtmsktermg
mglyvkydgdpwadsdalafsgvmvsmkepgwysfgfeikdkecdvpcigiemvhdggke
twhsaataiyclmgsgqllwdtvtgvdmal

SCOPe Domain Coordinates for d4cpzg_:

Click to download the PDB-style file with coordinates for d4cpzg_.
(The format of our PDB-style files is described here.)

Timeline for d4cpzg_: