Lineage for d4cpya_ (4cpy A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2064980Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 2064981Superfamily b.68.1: Sialidases [50939] (3 families) (S)
  5. 2064982Family b.68.1.1: Sialidases (neuraminidases) [50940] (10 protein domains)
  6. 2065266Protein automated matches [193245] (14 species)
    not a true protein
  7. 2065338Species Influenza B virus [TaxId:11520] [256642] (3 PDB entries)
  8. 2065339Domain d4cpya_: 4cpy A: [266018]
    automated match to d1infa_
    complexed with ca, edo, g39, nag

Details for d4cpya_

PDB Entry: 4cpy (more details), 1.8 Å

PDB Description: Structure of the Neuraminidase from the B/Lyon/CHU/15.216/2011 virus in complex with Oseltamivir
PDB Compounds: (A:) Neuraminidase

SCOPe Domain Sequences for d4cpya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4cpya_ b.68.1.1 (A:) automated matches {Influenza B virus [TaxId: 11520]}
epewtyprlscpgstfqkallisphrfgetkgnsapliirepfiacgpneckhfalthya
aqpggyyngtrgdrnklrhlisvklgkiptvensifhmaawsgsachdgkewtyigvdgp
dndallkvkygeaytdtyhsyankllrtqesacnciggncylmitdgsasgvsecrflki
regriikeifptgrvkhteectcgfasnktiecacrdnsytakrpfvklnvetdtaeirl
mctdtyldtprpddgsitgpcesngdkgsggikggfvhqrmeskigrwysrtmsktermg
mglyvkydgdpwadsdalafsgvmvsmkepgwysfgfeikdkecdvpcigiemvhdggke
twhsaataiyclmgsgqllwdtvtgvdmal

SCOPe Domain Coordinates for d4cpya_:

Click to download the PDB-style file with coordinates for d4cpya_.
(The format of our PDB-style files is described here.)

Timeline for d4cpya_: