Lineage for d4cpmb_ (4cpm B:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2417088Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 2417089Superfamily b.68.1: Sialidases [50939] (3 families) (S)
  5. 2417090Family b.68.1.1: Sialidases (neuraminidases) [50940] (10 proteins)
  6. 2417430Protein automated matches [193245] (22 species)
    not a true protein
  7. 2417521Species Influenza B virus (b/brisbane/60/2008) [TaxId:604436] [256640] (3 PDB entries)
  8. 2417527Domain d4cpmb_: 4cpm B: [266017]
    automated match to d1infa_
    complexed with ca, edo, g39, nag

Details for d4cpmb_

PDB Entry: 4cpm (more details), 2.75 Å

PDB Description: structure of the neuraminidase from the b/brisbane/60/2008 virus in complex with oseltamivir
PDB Compounds: (B:) Neuraminidase

SCOPe Domain Sequences for d4cpmb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4cpmb_ b.68.1.1 (B:) automated matches {Influenza B virus (b/brisbane/60/2008) [TaxId: 604436]}
epewtyprlscpgstfqkallisphrfgetkgnsapliirepfiacgpneckhfalthya
aqpggyyngtrgdrnklrhlisvklgkiptvensifhmaawsgsachdgkewtyigvdgp
dnnallkvkygeaytdtyhsyankilrtqesacnciggncylmitdgsasgvsecrflki
regriikeifptgrvkhteectcgfasnktiecacrdnsytakrpfvklnvetdtaeirl
mctdtyldtprpndgsitgpcesngdkgsggikggfvhqrmeskigrwysrtmsktermg
mglyvkydgdpwadsdalafsgvmvsmkepgwysfgfeikdkkcdvpcigiemvhdggke
twhsaataiyclmgsgqllwdtvtgvdmal

SCOPe Domain Coordinates for d4cpmb_:

Click to download the PDB-style file with coordinates for d4cpmb_.
(The format of our PDB-style files is described here.)

Timeline for d4cpmb_: