SCOPe 2.05: Domain d4co5a_: 4co5 A:

Lineage for d4co5a_ (4co5 A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.5: GlnB-like [54913] (6 families)
   form timeric structures with the orthogonally packed beta-sheets

5. Family d.58.5.1: Prokaryotic signal transducing protein [54914] (4 proteins)

6. Protein automated matches [190670] (6 species)
   not a true protein

7. Species Azospirillum brasilense [TaxId:192] [189362] (10 PDB entries)

8. Domain d4co5a_: 4co5 A: [266015]
   automated match to d3mhya_
   complexed with tla

Details for d4co5a_

PDB Entry: 4co5, 1.8 Å

PDB Description: structure of pii signaling protein glnz from azospirillum brasilense in complex with tartrate

PDB Compounds: (A:) PII-like protein Pz

SCOPe Domain Sequences for d4co5a_:

Sequence, based on SEQRES records:

>d4co5a_ d.58.5.1 (A:) automated matches {Azospirillum brasilense [TaxId: 192]}
mklvmaiikpfkldevrealtslgiqgltvsevkgfgrqkgqteiyrgaeysvsflpkvk
vevavsddqyeqvveaiqkaantgrigdgkifvldiaqavrirtgetn

Sequence, based on observed residues (ATOM records):

>d4co5a_ d.58.5.1 (A:) automated matches {Azospirillum brasilense [TaxId: 192]}
mklvmaiikpfkldevrealtslgiqgltvsevkgfgqteiyrgaeysvsflpkvkveva
vsddqyeqvveaiqkaantgrigdgkifvldiaqavrirtgetn

Timeline for d4co5a_:

• d4co5a_ is new in SCOPe 2.05-stable
  
• d4co5a_ appears in SCOPe 2.06
  
• d4co5a_ appears in the current release, SCOPe 2.08