Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.5: GlnB-like [54913] (6 families) form timeric structures with the orthogonally packed beta-sheets |
Family d.58.5.1: Prokaryotic signal transducing protein [54914] (4 proteins) |
Protein automated matches [190670] (6 species) not a true protein |
Species Azospirillum brasilense [TaxId:192] [189362] (11 PDB entries) |
Domain d4co1b_: 4co1 B: [266007] automated match to d3mhya_ complexed with adp |
PDB Entry: 4co1 (more details), 1.5 Å
SCOPe Domain Sequences for d4co1b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4co1b_ d.58.5.1 (B:) automated matches {Azospirillum brasilense [TaxId: 192]} mklvmaiikpfkldevrealtslgiqgltvsevkgfgrqkgqteiyrgaeysvsflpkvk vevavsddqyeqvveaiqkaantgrigdgkifvldiaqavrirtgetnteal
Timeline for d4co1b_: