Lineage for d4co0a_ (4co0 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2950563Superfamily d.58.5: GlnB-like [54913] (6 families) (S)
    form timeric structures with the orthogonally packed beta-sheets
  5. 2950564Family d.58.5.1: Prokaryotic signal transducing protein [54914] (4 proteins)
  6. 2950640Protein automated matches [190670] (7 species)
    not a true protein
  7. 2950641Species Azospirillum brasilense [TaxId:192] [189362] (11 PDB entries)
  8. 2950648Domain d4co0a_: 4co0 A: [266004]
    automated match to d3mhya_
    complexed with adp, tla

Details for d4co0a_

PDB Entry: 4co0 (more details), 1.4 Å

PDB Description: structure of pii signaling protein glnz from azospirillum brasilense in complex with adenosine diphosphate
PDB Compounds: (A:) PII-like protein Pz

SCOPe Domain Sequences for d4co0a_:

Sequence, based on SEQRES records: (download)

>d4co0a_ d.58.5.1 (A:) automated matches {Azospirillum brasilense [TaxId: 192]}
mklvmaiikpfkldevrealtslgiqgltvsevkgfgrqkgqteiyrgaeysvsflpkvk
vevavsddqyeqvveaiqkaantgrigdgkifvldiaqavrirtgetnteal

Sequence, based on observed residues (ATOM records): (download)

>d4co0a_ d.58.5.1 (A:) automated matches {Azospirillum brasilense [TaxId: 192]}
mklvmaiikpfkldevrealtslgiqgltvsevkgfgrqteiyrgaeysvsflpkvkvev
avsddqyeqvveaiqkaantgrigdgkifvldiaqavrirtgetnteal

SCOPe Domain Coordinates for d4co0a_:

Click to download the PDB-style file with coordinates for d4co0a_.
(The format of our PDB-style files is described here.)

Timeline for d4co0a_: