Lineage for d4cj9b_ (4cj9 B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2016947Fold a.298: Left-handed alpha-alpha superhelix [267589] (1 superfamily)
    multihelical; 2 (curved) layers: alpha/alpha; left-handed superhelix
  4. 2016948Superfamily a.298.1: TAL effector-like [267596] (1 family) (S)
    Pfam PF03377; repeat; repeats form left-handed bundles that associate in a right-handed superstructure. PubMed 22223736
  5. 2016949Family a.298.1.1: TAL (transcription activator-like) effector [267609] (5 protein domains)
  6. 2016950Protein BurrH [267647] (1 species)
  7. 2016951Species Burkholderia rhizoxinica [TaxId:412963] [267706] (2 PDB entries)
  8. 2016953Domain d4cj9b_: 4cj9 B: [265997]
    complexed with se

Details for d4cj9b_

PDB Entry: 4cj9 (more details), 2.21 Å

PDB Description: BurrH DNA-binding protein from Burkholderia rhizoxinica in its apo form
PDB Compounds: (B:) burrh

SCOPe Domain Sequences for d4cj9b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4cj9b_ a.298.1.1 (B:) BurrH {Burkholderia rhizoxinica [TaxId: 412963]}
lnlsplerskiekqyggattlafisnkqnelaqilsradilkiasydcaahalqavldcg
pmlgkrgfsqsdivkiagniggaqalqavldlesmlgkrgfsrddiakmagniggaqtlq
avldlesafrergfsqadivkiagnnggaqalysvldveptlgkrgfsradivkiagntg
gaqalhtvldlepalgkrgfsridivkiaannggaqalhavldlgptlrecgfsqatiak
iagniggaqalqmvldlgpalgkrgfsqatiakiagniggaqalqtvldlepalcergfs
qatiakmagnnggaqalqtvldlepalrkrdfrqadiikiagndggaqalqaviehgptl
rqhgfnladivkmagniggaqalqavldlkpvldehgfsqpdivkmagniggaqalqavl
slgpalrergfsqpdivkiagntggaqalqavldleltlvehgfsqpdivritgnrggaq
alqavlaleltlrergfsqpdivkiagnsggaqalqavldleltfrergfsqadivkiag
ndggtqalhavldlermlgergfsradivnvagnnggaqalkavleheatlnergfsrad
ivkiagngggaqalkavleheatldergfsradivriagngggaqalkavlehgptlner
gfnltdivemaansggaqalkavlehgptlrqrglslidiveiasnggaqalkavlkygp
vlmqagrsneeivhvaarrggagrirkmvapl

SCOPe Domain Coordinates for d4cj9b_:

Click to download the PDB-style file with coordinates for d4cj9b_.
(The format of our PDB-style files is described here.)

Timeline for d4cj9b_: