Lineage for d4c7xa3 (4c7x A:527-662)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1855607Fold c.48: TK C-terminal domain-like [52921] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 13245, strand 1 is antiparallel to the rest
  4. 1855608Superfamily c.48.1: TK C-terminal domain-like [52922] (4 families) (S)
  5. 1855774Family c.48.1.0: automated matches [227237] (1 protein)
    not a true family
  6. 1855775Protein automated matches [226991] (5 species)
    not a true protein
  7. 1855804Species Lactobacillus salivarius [TaxId:362948] [260147] (2 PDB entries)
  8. 1855806Domain d4c7xa3: 4c7x A:527-662 [265993]
    Other proteins in same PDB: d4c7xa1, d4c7xa2
    automated match to d4c7va3
    complexed with mg, tpp

Details for d4c7xa3

PDB Entry: 4c7x (more details), 2.29 Å

PDB Description: thiamine pyrophosphate bound transketolase from lactobacillus salivarius at 2.2a resolution
PDB Compounds: (A:) transketolase

SCOPe Domain Sequences for d4c7xa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d4c7xa3 c.48.1.0 (A:527-662) automated matches {Lactobacillus salivarius [TaxId: 362948]}
piskekvfdgvekggyvvqgaeneadgiliatgsevglalkakeelqkkgkdvivvslps
werfeaqseeykntvippelkkrmtieagttygwakyagdhgvmigidefgmsapsdivl
relgmsvenivdkyle

SCOPe Domain Coordinates for d4c7xa3:

Click to download the PDB-style file with coordinates for d4c7xa3.
(The format of our PDB-style files is described here.)

Timeline for d4c7xa3: