Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.72: Ribokinase-like [53612] (3 superfamilies) core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest potential superfamily: members of this fold have similar functions but different ATP-binding sites |
Superfamily c.72.1: Ribokinase-like [53613] (6 families) has extra strand located between strands 2 and 3 |
Family c.72.1.0: automated matches [191321] (1 protein) not a true family |
Protein automated matches [190117] (37 species) not a true protein |
Species Staphylococcus aureus [TaxId:158878] [237768] (4 PDB entries) |
Domain d4c5lb_: 4c5l B: [265984] automated match to d4c5na_ complexed with pxl, so4, ueg |
PDB Entry: 4c5l (more details), 1.85 Å
SCOPe Domain Sequences for d4c5lb_:
Sequence, based on SEQRES records: (download)
>d4c5lb_ c.72.1.0 (B:) automated matches {Staphylococcus aureus [TaxId: 158878]} galkkvltiagsdtsagagmqadlktfqeldtygmvaltaivtmdkdtwshdvtplpmdv fekqletalsigpdaiktgmlgteeiikragevyeasnaqyfvvdpvmvckgedevlnpg nteamikyllpkatvvtpnlfeagqlsglgklnsiedmkkaatiifdkgaqhviikggka ldqdksydlyydgqtfyqlttdmfqqsynhgagctfaaattaylangkspkeavisakaf vasaikngwkmndfvgpvdhgaynriehidvevtev
>d4c5lb_ c.72.1.0 (B:) automated matches {Staphylococcus aureus [TaxId: 158878]} galkkvltiagsdtsagagmqadlktfqeldtygmvaltaivtmdkdtwshdvtplpmdv fekqletalsigpdaiktgmlgteeiikragevyeasnaqyfvvdpvmvdevlnpgntea mikyllpkatvvtpnlfeagqlsglgklnsiedmkkaatiifdkgaqhviikggkaldqd ksydlyydgqtfyqlttdmfqsynhgagctfaaattaylangkspkeavisakafvasai kngwkmndfvgpvdhgaynriehidvevtev
Timeline for d4c5lb_: