Lineage for d4c5kd_ (4c5k D:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1872415Fold c.72: Ribokinase-like [53612] (3 superfamilies)
    core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
    potential superfamily: members of this fold have similar functions but different ATP-binding sites
  4. 1872416Superfamily c.72.1: Ribokinase-like [53613] (6 families) (S)
    has extra strand located between strands 2 and 3
  5. 1872643Family c.72.1.0: automated matches [191321] (1 protein)
    not a true family
  6. 1872644Protein automated matches [190117] (37 species)
    not a true protein
  7. 1872833Species Staphylococcus aureus [TaxId:158878] [237768] (4 PDB entries)
  8. 1872837Domain d4c5kd_: 4c5k D: [265982]
    automated match to d4c5na_
    complexed with adp, so4

Details for d4c5kd_

PDB Entry: 4c5k (more details), 1.4 Å

PDB Description: Structure of the pyridoxal kinase from Staphylococcus aureus in complex with ADP
PDB Compounds: (D:) phosphomethylpyrimidine kinase

SCOPe Domain Sequences for d4c5kd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4c5kd_ c.72.1.0 (D:) automated matches {Staphylococcus aureus [TaxId: 158878]}
galkkvltiagsdtsagagmqadlktfqeldtygmvaltaivtmdkdtwshdvtplpmdv
fekqletalsigpdaiktgmlgteeiikragevyeasnaqyfvvdpvmvckgedevlnpg
nteamikyllpkatvvtpnlfeagqlsglgklnsiedmkkaatiifdkgaqhviikggka
ldqdksydlyydgqtfyqlttdmfqqsynhgagctfaaattaylangkspkeavisakaf
vasaikngwkmndfvgpvdhgaynriehidvevtev

SCOPe Domain Coordinates for d4c5kd_:

Click to download the PDB-style file with coordinates for d4c5kd_.
(The format of our PDB-style files is described here.)

Timeline for d4c5kd_:

  • d4c5kd_ is new in SCOPe 2.05-stable
  • d4c5kd_ appears in the current release, SCOPe 2.06, called d4c5kd1