SCOPe 2.08: Domain d4c3kf1: 4c3k F:1-112

Lineage for d4c3kf1 (4c3k F:1-112)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.5: GlnB-like [54913] (6 families)
   form timeric structures with the orthogonally packed beta-sheets

5. Family d.58.5.1: Prokaryotic signal transducing protein [54914] (4 proteins)

6. Protein automated matches [190670] (7 species)
   not a true protein

7. Species Synechococcus elongatus [TaxId:32046] [189889] (2 PDB entries)

8. Domain d4c3kf1: 4c3k F:1-112 [265978]
   Other proteins in same PDB: d4c3ka2, d4c3kd2, d4c3kf2
   automated match to d2xzwa_
   complexed with adp, po4

Details for d4c3kf1

PDB Entry: 4c3k, 3.1 Å

PDB Description: Structure of mixed PII-ADP complexes from S. elongatus

PDB Compounds: (F:) nitrogen regulatory protein p-II

SCOPe Domain Sequences for d4c3kf1:

Sequence, based on SEQRES records:

>d4c3kf1 d.58.5.1 (F:1-112) automated matches {Synechococcus elongatus [TaxId: 32046]}
mkkieaiirpfkldevkialvnagivgmtvsevrgfgrqkgqteryrgseytveflqklk
leivvedaqvdtvidkivaaartgeigdgkifvspvdqtirirtgeknadai

Sequence, based on observed residues (ATOM records):

>d4c3kf1 d.58.5.1 (F:1-112) automated matches {Synechococcus elongatus [TaxId: 32046]}
mkkieaiirpfkldevkialvnagivgmtvsevrgfgrqkgytveflqklkleivvedaq
vdtvidkivaaartgeigdgkifvspvdqtirirtgeknadai

Timeline for d4c3kf1:

• d4c3kf1 first appeared in SCOPe 2.05, called d4c3kf_
  
• d4c3kf1 appears in SCOPe 2.07