SCOPe 2.05: Domain d4c3kc_: 4c3k C:

Lineage for d4c3kc_ (4c3k C:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.5: GlnB-like [54913] (6 families)
   form timeric structures with the orthogonally packed beta-sheets

5. Family d.58.5.1: Prokaryotic signal transducing protein [54914] (4 proteins)

6. Protein automated matches [190670] (6 species)
   not a true protein

7. Species Synechococcus elongatus [TaxId:32046] [189889] (2 PDB entries)

8. Domain d4c3kc_: 4c3k C: [265975]
   automated match to d2xzwa_
   complexed with adp, po4

Details for d4c3kc_

PDB Entry: 4c3k, 3.1 Å

PDB Description: Structure of mixed PII-ADP complexes from S. elongatus

PDB Compounds: (C:) nitrogen regulatory protein p-II

SCOPe Domain Sequences for d4c3kc_:

Sequence, based on SEQRES records:

>d4c3kc_ d.58.5.1 (C:) automated matches {Synechococcus elongatus [TaxId: 32046]}
mkkieaiirpfkldevkialvnagivgmtvsevrgfgrqkgqteryrgseytveflqklk
leivvedaqvdtvidkivaaartgeigdgkifvspvdqtirirtgekn

Sequence, based on observed residues (ATOM records):

>d4c3kc_ d.58.5.1 (C:) automated matches {Synechococcus elongatus [TaxId: 32046]}
mkkieaiirpfkldevkialvnagivgmtvsevrgfgrqeytveflqklkleivvedaqv
dtvidkivaaartgeigdgkifvspvdqtirirtgekn

Timeline for d4c3kc_:

• d4c3kc_ is new in SCOPe 2.05-stable
  
• d4c3kc_ appears in SCOPe 2.06
  
• d4c3kc_ appears in the current release, SCOPe 2.08