Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.5: GlnB-like [54913] (6 families) form timeric structures with the orthogonally packed beta-sheets |
Family d.58.5.1: Prokaryotic signal transducing protein [54914] (4 proteins) |
Protein automated matches [190670] (7 species) not a true protein |
Species Synechococcus elongatus [TaxId:32046] [189889] (2 PDB entries) |
Domain d4c3kc_: 4c3k C: [265975] Other proteins in same PDB: d4c3ka2, d4c3kd2, d4c3kf2 automated match to d2xzwa_ complexed with adp, po4 |
PDB Entry: 4c3k (more details), 3.1 Å
SCOPe Domain Sequences for d4c3kc_:
Sequence, based on SEQRES records: (download)
>d4c3kc_ d.58.5.1 (C:) automated matches {Synechococcus elongatus [TaxId: 32046]} mkkieaiirpfkldevkialvnagivgmtvsevrgfgrqkgqteryrgseytveflqklk leivvedaqvdtvidkivaaartgeigdgkifvspvdqtirirtgekn
>d4c3kc_ d.58.5.1 (C:) automated matches {Synechococcus elongatus [TaxId: 32046]} mkkieaiirpfkldevkialvnagivgmtvsevrgfgrqeytveflqklkleivvedaqv dtvidkivaaartgeigdgkifvspvdqtirirtgekn
Timeline for d4c3kc_: