Lineage for d4c3kb_ (4c3k B:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1906287Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1907450Superfamily d.58.5: GlnB-like [54913] (6 families) (S)
    form timeric structures with the orthogonally packed beta-sheets
  5. 1907451Family d.58.5.1: Prokaryotic signal transducing protein [54914] (4 protein domains)
  6. 1907525Protein automated matches [190670] (6 species)
    not a true protein
  7. 1907580Species Synechococcus elongatus [TaxId:32046] [189889] (2 PDB entries)
  8. 1907583Domain d4c3kb_: 4c3k B: [265974]
    automated match to d2xzwa_
    complexed with adp, po4

Details for d4c3kb_

PDB Entry: 4c3k (more details), 3.1 Å

PDB Description: Structure of mixed PII-ADP complexes from S. elongatus
PDB Compounds: (B:) nitrogen regulatory protein p-II

SCOPe Domain Sequences for d4c3kb_:

Sequence, based on SEQRES records: (download)

>d4c3kb_ d.58.5.1 (B:) automated matches {Synechococcus elongatus [TaxId: 32046]}
mkkieaiirpfkldevkialvnagivgmtvsevrgfgrqkgqteryrgseytveflqklk
leivvedaqvdtvidkivaaartgeigdgkifvspvdqtirirtgekn

Sequence, based on observed residues (ATOM records): (download)

>d4c3kb_ d.58.5.1 (B:) automated matches {Synechococcus elongatus [TaxId: 32046]}
mkkieaiirpfkldevkialvnagivgmtvsevrgfflqklkleivvedaqvdtvidkiv
aaartgeigdgkifvspvdqtirirtgekn

SCOPe Domain Coordinates for d4c3kb_:

Click to download the PDB-style file with coordinates for d4c3kb_.
(The format of our PDB-style files is described here.)

Timeline for d4c3kb_: