Lineage for d4c3ka1 (4c3k A:1-112)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2950563Superfamily d.58.5: GlnB-like [54913] (6 families) (S)
    form timeric structures with the orthogonally packed beta-sheets
  5. 2950564Family d.58.5.1: Prokaryotic signal transducing protein [54914] (4 proteins)
  6. 2950640Protein automated matches [190670] (7 species)
    not a true protein
  7. 2950712Species Synechococcus elongatus [TaxId:32046] [189889] (2 PDB entries)
  8. 2950714Domain d4c3ka1: 4c3k A:1-112 [265973]
    Other proteins in same PDB: d4c3ka2, d4c3kd2, d4c3kf2
    automated match to d2xzwa_
    complexed with adp, po4

Details for d4c3ka1

PDB Entry: 4c3k (more details), 3.1 Å

PDB Description: Structure of mixed PII-ADP complexes from S. elongatus
PDB Compounds: (A:) nitrogen regulatory protein p-II

SCOPe Domain Sequences for d4c3ka1:

Sequence, based on SEQRES records: (download)

>d4c3ka1 d.58.5.1 (A:1-112) automated matches {Synechococcus elongatus [TaxId: 32046]}
mkkieaiirpfkldevkialvnagivgmtvsevrgfgrqkgqteryrgseytveflqklk
leivvedaqvdtvidkivaaartgeigdgkifvspvdqtirirtgeknadai

Sequence, based on observed residues (ATOM records): (download)

>d4c3ka1 d.58.5.1 (A:1-112) automated matches {Synechococcus elongatus [TaxId: 32046]}
mkkieaiirpfkldevkialvnagivgmtvsevrgfeflqklkleivvedaqvdtvidki
vaaartgeigdgkifvspvdqtirirtgeknadai

SCOPe Domain Coordinates for d4c3ka1:

Click to download the PDB-style file with coordinates for d4c3ka1.
(The format of our PDB-style files is described here.)

Timeline for d4c3ka1: