SCOPe 2.05: Domain d4c1ta_: 4c1t A:

Lineage for d4c1ta_ (4c1t A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.0: automated matches [191309] (1 protein)
   not a true family

6. Protein automated matches [190039] (120 species)
   not a true protein

7. Species Bifidobacterium animalis [TaxId:580050] [267917] (4 PDB entries)

8. Domain d4c1ta_: 4c1t A: [265971]
   automated match to d3jzja_
   complexed with 1pe

Details for d4c1ta_

PDB Entry: 4c1t, 2.39 Å

PDB Description: structure of the xylo-oligosaccharide specific solute binding protein from bifidobacterium animalis subsp. lactis bl-04 in complex with arabinoxylotriose

PDB Compounds: (A:) sugar transporter solute-binding protein

SCOPe Domain Sequences for d4c1ta_:

Sequence; same for both SEQRES and ATOM records:

>d4c1ta_ c.94.1.0 (A:) automated matches {Bifidobacterium animalis [TaxId: 580050]}
ddktitfwhnasagegrqywenlaksfeeanpgtkveiqaiqnedfagklqtamqdpasg
pdvfmslggaktkemidagqvmdltdkisdtvktdmkttlsaatfdgkvygvpvsvepgg
mwyskdlfkkagvsdvpatyeelladakklkdsgtdaialgakdawpaahwyywlvlrec
spevydksvqdhdfsnacwvnagkklqelkdlkvfndgfltttaqqganssagllanhka
amelmgawepgvlkdltpdqkpmadlgffafpevaggegepgalmggvtyfcvnpkasqt
sidfvnymgekknqedyakafstipaseparavvtdeslkqvieyldkapsmqlwmdtal
gtnignalnaavvnmlsgqgspedivkamqdaaqkg

Timeline for d4c1ta_:

• d4c1ta_ is new in SCOPe 2.05-stable
  
• d4c1ta_ appears in SCOPe 2.06
  
• d4c1ta_ appears in the current release, SCOPe 2.08