Lineage for d4c1ta_ (4c1t A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2913607Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2913608Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2915150Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 2915151Protein automated matches [190039] (161 species)
    not a true protein
  7. 2915288Species Bifidobacterium animalis [TaxId:580050] [267917] (4 PDB entries)
  8. 2915291Domain d4c1ta_: 4c1t A: [265971]
    automated match to d3jzja_
    complexed with 1pe

Details for d4c1ta_

PDB Entry: 4c1t (more details), 2.39 Å

PDB Description: structure of the xylo-oligosaccharide specific solute binding protein from bifidobacterium animalis subsp. lactis bl-04 in complex with arabinoxylotriose
PDB Compounds: (A:) sugar transporter solute-binding protein

SCOPe Domain Sequences for d4c1ta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4c1ta_ c.94.1.0 (A:) automated matches {Bifidobacterium animalis [TaxId: 580050]}
ddktitfwhnasagegrqywenlaksfeeanpgtkveiqaiqnedfagklqtamqdpasg
pdvfmslggaktkemidagqvmdltdkisdtvktdmkttlsaatfdgkvygvpvsvepgg
mwyskdlfkkagvsdvpatyeelladakklkdsgtdaialgakdawpaahwyywlvlrec
spevydksvqdhdfsnacwvnagkklqelkdlkvfndgfltttaqqganssagllanhka
amelmgawepgvlkdltpdqkpmadlgffafpevaggegepgalmggvtyfcvnpkasqt
sidfvnymgekknqedyakafstipaseparavvtdeslkqvieyldkapsmqlwmdtal
gtnignalnaavvnmlsgqgspedivkamqdaaqkg

SCOPe Domain Coordinates for d4c1ta_:

Click to download the PDB-style file with coordinates for d4c1ta_.
(The format of our PDB-style files is described here.)

Timeline for d4c1ta_: