Lineage for d4c04a_ (4c04 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2129295Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2129296Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2130608Family c.66.1.0: automated matches [191451] (1 protein)
    not a true family
  6. 2130609Protein automated matches [190689] (64 species)
    not a true protein
  7. 2130813Species Mouse (Mus musculus) [TaxId:10090] [187843] (16 PDB entries)
  8. 2130822Domain d4c04a_: 4c04 A: [265965]
    automated match to d4qppa_
    complexed with sfg

Details for d4c04a_

PDB Entry: 4c04 (more details), 1.58 Å

PDB Description: crystal structure of m. musculus protein arginine methyltransferase prmt6 with inhibitor
PDB Compounds: (A:) Protein arginine N-methyltransferase 6

SCOPe Domain Sequences for d4c04a_:

Sequence, based on SEQRES records: (download)

>d4c04a_ c.66.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qlyyecysdvsvheemiadqvrteayrlgilknwaalrgktvldvgagtgilsifcaqag
arrvyaveasaiwqqarevvrlngledrvhvlpgpvetvelpervdaivsewmgygllhe
smlssvlhartkwlkegglllpasaelfvapisdqmlewrlgfwsqvkqhygvdmscmes
fatrclmghseivvqdlsgedvlarpqrfaqlelaragleqeleagvggrfrcscygsap
lhgfavwfqvtfpggdsekplvlstsplhpathwkqallylnepvpveqdtdisgeitll
pspdnprrlrillrykvgdheektkdfame

Sequence, based on observed residues (ATOM records): (download)

>d4c04a_ c.66.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qlyyecysdvsvheemiadqvrteayrlgilknwaalrgktvldvgagtgilsifcaqag
arrvyaveasaiwqqarevvrlngledrvhvlpgpvetvelpervdaivsewmgygllhe
smlssvlhartkwlkegglllpasaelfvapisdqmlewrlgfwsqvkqhygvdmscmes
fatrclmghseivvqdlsgedvlarpqrfaqlelaragleqeleagvggrfrcscygsap
lhgfavwfqvtfpggkplvlstsplhpathwkqallylnepvpveqdtdisgeitllpsp
dnprrlrillrykvgdheektkdfame

SCOPe Domain Coordinates for d4c04a_:

Click to download the PDB-style file with coordinates for d4c04a_.
(The format of our PDB-style files is described here.)

Timeline for d4c04a_: