Lineage for d4bwma2 (4bwm A:423-832)

  1. Root: SCOPe 2.07
  2. 2568173Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2571153Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 2571154Superfamily e.8.1: DNA/RNA polymerases [56672] (8 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 2571155Family e.8.1.1: DNA polymerase I [56673] (5 proteins)
  6. 2571448Protein automated matches [226972] (9 species)
    not a true protein
  7. 2571499Species Thermus aquaticus [TaxId:271] [267868] (4 PDB entries)
  8. 2571501Domain d4bwma2: 4bwm A:423-832 [265960]
    Other proteins in same PDB: d4bwma1
    automated match to d3rrha2
    protein/DNA complex; protein/RNA complex; complexed with cl, dct, fmt, mg; mutant

Details for d4bwma2

PDB Entry: 4bwm (more details), 1.75 Å

PDB Description: klentaq mutant in complex with a rna/dna hybrid
PDB Compounds: (A:) DNA polymerase I, thermostable

SCOPe Domain Sequences for d4bwma2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4bwma2 e.8.1.1 (A:423-832) automated matches {Thermus aquaticus [TaxId: 271]}
eerllwlyreverplsavlahmeatgvrldvaylramslevaeeiarleaevfrlaghpf
nlnsrdqlervlfdelglpaigktektgkrstraavlealreahpivekilqyreltklk
styidplpdlihprtgrlhtrfnqtatatgrlsssdpnlqnipvrtplgqrirrafiaee
gwllvaldysqielrvlahlsgdenlirvfqegrdfhtetaswmfgvpreavdplmrraa
ktinfgvlygmsahrlsqelaipyeeaqafieryfqsfpkvrawiektleegrrrgyvet
lfgrrryvpdlearvksvreaaerkafnmpvqgtaadlmklamvklfprleemgarmllq
vhdelvleapkeraeavarlakevmegvyplavplevevgigedwlsake

SCOPe Domain Coordinates for d4bwma2:

Click to download the PDB-style file with coordinates for d4bwma2.
(The format of our PDB-style files is described here.)

Timeline for d4bwma2: