| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.3: Ribonuclease H-like [53098] (18 families) ![]() consists of one domain of this fold |
| Family c.55.3.0: automated matches [191357] (1 protein) not a true family |
| Protein automated matches [190396] (40 species) not a true protein |
| Species Thermus aquaticus [TaxId:271] [267867] (4 PDB entries) |
| Domain d4bwma1: 4bwm A:295-422 [265959] Other proteins in same PDB: d4bwma2 automated match to d1bgxt3 protein/DNA complex; protein/RNA complex; complexed with cl, dct, fmt, mg; mutant |
PDB Entry: 4bwm (more details), 1.75 Å
SCOPe Domain Sequences for d4bwma1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4bwma1 c.55.3.0 (A:295-422) automated matches {Thermus aquaticus [TaxId: 271]}
eeapwpppegafvgfvlsrkepmwadllalaaarggrvhrapepykalrdlkeargllak
dlsvlalreglglppgddpmllaylldpsnttpegvarryggewteeageraalserlfa
nlwgrleg
Timeline for d4bwma1: