Lineage for d4bqve_ (4bqv E:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2173267Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 2173268Superfamily d.3.1: Cysteine proteinases [54001] (24 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 2173269Family d.3.1.1: Papain-like [54002] (26 proteins)
  6. 2173617Protein automated matches [190264] (11 species)
    not a true protein
  7. 2173664Species Mouse (Mus musculus) [TaxId:10090] [229208] (7 PDB entries)
  8. 2173680Domain d4bqve_: 4bqv E: [265951]
    automated match to d4bs5a_
    complexed with 8pw

Details for d4bqve_

PDB Entry: 4bqv (more details), 1.7 Å

PDB Description: mouse cathepsin s with covalent ligand
PDB Compounds: (E:) cathepsin S

SCOPe Domain Sequences for d4bqve_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4bqve_ d.3.1.1 (E:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
tlpdtvdwrekgcvtevkyqgscgacwafsavgalegqlklktgklislsaqnlvdcsne
ekygnkgcgggymteafqyiidnggieadasypykamdekchynsknraatcsryiqlpf
gdedalkeavatkgpvsvgidashssfffyksgvyddpsctgnvnhgvlvvgygtldgkd
ywlvknswglnfgdqgyirmarnnknhcgiasycsypei

SCOPe Domain Coordinates for d4bqve_:

Click to download the PDB-style file with coordinates for d4bqve_.
(The format of our PDB-style files is described here.)

Timeline for d4bqve_: