![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
![]() | Superfamily d.3.1: Cysteine proteinases [54001] (24 families) ![]() the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
![]() | Family d.3.1.1: Papain-like [54002] (26 proteins) |
![]() | Protein automated matches [190264] (12 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [229208] (7 PDB entries) |
![]() | Domain d4bqvd_: 4bqv D: [265950] automated match to d4bs5a_ complexed with 8pw |
PDB Entry: 4bqv (more details), 1.7 Å
SCOPe Domain Sequences for d4bqvd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4bqvd_ d.3.1.1 (D:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} tlpdtvdwrekgcvtevkyqgscgacwafsavgalegqlklktgklislsaqnlvdcsne ekygnkgcgggymteafqyiidnggieadasypykamdekchynsknraatcsryiqlpf gdedalkeavatkgpvsvgidashssfffyksgvyddpsctgnvnhgvlvvgygtldgkd ywlvknswglnfgdqgyirmarnnknhcgiasycsypei
Timeline for d4bqvd_: