![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies) 4 helices, bundle; helix 3 is shorter than others; up-and-down |
![]() | Superfamily a.28.1: ACP-like [47336] (4 families) ![]() |
![]() | Family a.28.1.0: automated matches [191582] (1 protein) not a true family |
![]() | Protein automated matches [191038] (29 species) not a true protein |
![]() | Species Bacillus subtilis [TaxId:1423] [256569] (3 PDB entries) |
![]() | Domain d4bpha1: 4bph A:1-78 [265944] Other proteins in same PDB: d4bpha2 automated match to d4bpfa_ complexed with mg, pns |
PDB Entry: 4bph (more details), 1.8 Å
SCOPe Domain Sequences for d4bpha1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4bpha1 a.28.1.0 (A:1-78) automated matches {Bacillus subtilis [TaxId: 1423]} mdfkqevldvlaevcqddivkenpdieifeeglldsfgtvelllaienrfdilvpitefd rdvwntpnnivnqlselk
Timeline for d4bpha1: