Lineage for d4bpha1 (4bph A:1-78)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2706108Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
    4 helices, bundle; helix 3 is shorter than others; up-and-down
  4. 2706109Superfamily a.28.1: ACP-like [47336] (4 families) (S)
  5. 2706248Family a.28.1.0: automated matches [191582] (1 protein)
    not a true family
  6. 2706249Protein automated matches [191038] (29 species)
    not a true protein
  7. 2706255Species Bacillus subtilis [TaxId:1423] [256569] (3 PDB entries)
  8. 2706257Domain d4bpha1: 4bph A:1-78 [265944]
    Other proteins in same PDB: d4bpha2
    automated match to d4bpfa_
    complexed with mg, pns

Details for d4bpha1

PDB Entry: 4bph (more details), 1.8 Å

PDB Description: high resolution crystal structure of bacillus subtilis dltc
PDB Compounds: (A:) d-alanine--poly(phosphoribitol) ligase subunit 2

SCOPe Domain Sequences for d4bpha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4bpha1 a.28.1.0 (A:1-78) automated matches {Bacillus subtilis [TaxId: 1423]}
mdfkqevldvlaevcqddivkenpdieifeeglldsfgtvelllaienrfdilvpitefd
rdvwntpnnivnqlselk

SCOPe Domain Coordinates for d4bpha1:

Click to download the PDB-style file with coordinates for d4bpha1.
(The format of our PDB-style files is described here.)

Timeline for d4bpha1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4bpha2