Lineage for d4bnba_ (4bnb A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2963273Fold d.90: FMN-dependent nitroreductase-like [55468] (1 superfamily)
    core: (alpha-beta-alpha-beta)2; 3 layers a/b/a; antiparallel beta-sheet: 1243
  4. 2963274Superfamily d.90.1: FMN-dependent nitroreductase-like [55469] (3 families) (S)
  5. 2963435Family d.90.1.0: automated matches [191446] (1 protein)
    not a true family
  6. 2963436Protein automated matches [190672] (32 species)
    not a true protein
  7. 2963509Species Lactococcus lactis [TaxId:1358] [189386] (6 PDB entries)
  8. 2963511Domain d4bnba_: 4bnb A: [265943]
    automated match to d2wqfa_
    complexed with fmn, yhx

Details for d4bnba_

PDB Entry: 4bnb (more details), 1.48 Å

PDB Description: Nitroreductase CinD from Lactococcus lactis in complex with 4- nitroquinoline 1-oxide
PDB Compounds: (A:) copper induced nitroreductase d

SCOPe Domain Sequences for d4bnba_:

Sequence, based on SEQRES records: (download)

>d4bnba_ d.90.1.0 (A:) automated matches {Lactococcus lactis [TaxId: 1358]}
sfikslenrrtiyalgrnvqdeekvietikeavrfsptafnsqtgrlliltgdaqdklwd
eivapelkaameaqgvpesawdntrakldgfkaafgtilffedqavvknlqeqfalyadn
fpvwseqgsgiisvnvwtalaelglganlqhynplideavakewnlpeswklrgqlvfgs
ieapagektfmddadrfivak

Sequence, based on observed residues (ATOM records): (download)

>d4bnba_ d.90.1.0 (A:) automated matches {Lactococcus lactis [TaxId: 1358]}
sfikslenrrtiyalgrnvqdeekvietikeavrfsptafnsqtgrlliltgdaqdklwd
eivapelkaameaakldgfkaafgtilffedqavvknlqeqfalyadnfpvwseqgsgii
svnvwtalaelglganlqhynplideavakewnlpeswklrgqlvfgsieapagektfmd
dadrfivak

SCOPe Domain Coordinates for d4bnba_:

Click to download the PDB-style file with coordinates for d4bnba_.
(The format of our PDB-style files is described here.)

Timeline for d4bnba_: