Lineage for d1metb_ (1met B:)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 299835Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 299836Superfamily b.50.1: Acid proteases [50630] (2 families) (S)
  5. 299837Family b.50.1.1: Retroviral protease (retropepsin) [50631] (8 proteins)
    dimer of identical mono-domain chains, each containing (6,10) barrel
  6. 299853Protein Human immunodeficiency virus type 1 protease [50632] (1 species)
  7. 299854Species Human immunodeficiency virus type 1 [TaxId:11676] [50633] (152 PDB entries)
  8. 300020Domain d1metb_: 1met B: [26594]
    complexed with dmp; mutant

Details for d1metb_

PDB Entry: 1met (more details), 1.9 Å

PDB Description: hiv-1 mutant (v82f) protease complexed with dmp323

SCOP Domain Sequences for d1metb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1metb_ b.50.1.1 (B:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1}
pqvtlwqrplvtikiggqlkealldtgaddtvleemslpgrwkpkmiggiggfikvrqyd
qilieicghkaigtvlvgptpfniigrnlltqigctlnf

SCOP Domain Coordinates for d1metb_:

Click to download the PDB-style file with coordinates for d1metb_.
(The format of our PDB-style files is described here.)

Timeline for d1metb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1meta_