![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
![]() | Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) ![]() |
![]() | Family b.29.1.3: Galectin (animal S-lectin) [49932] (9 proteins) |
![]() | Protein Galectin-3 CRD [49940] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [49941] (85 PDB entries) |
![]() | Domain d4blja1: 4blj A:114-250 [265939] Other proteins in same PDB: d4blja2 automated match to d3zska_ complexed with 70b |
PDB Entry: 4blj (more details), 1.2 Å
SCOPe Domain Sequences for d4blja1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4blja1 b.29.1.3 (A:114-250) Galectin-3 CRD {Human (Homo sapiens) [TaxId: 9606]} livpynlplpggvvprmlitilgtvkpnanrialdfqrgndvafhfnprfnennrrvivc ntkldnnwgreerqsvfpfesgkpfkiqvlvepdhfkvavndahllqynhrvkklneisk lgisgdidltsasytmi
Timeline for d4blja1: