Lineage for d4bh6g_ (4bh6 G:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2418201Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 2418399Superfamily b.69.4: WD40 repeat-like [50978] (4 families) (S)
    also contains 8-bladed propellers
  5. 2418634Family b.69.4.0: automated matches [191412] (1 protein)
    not a true family
  6. 2418635Protein automated matches [190568] (9 species)
    not a true protein
  7. 2418636Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [267834] (3 PDB entries)
  8. 2418647Domain d4bh6g_: 4bh6 G: [265936]
    automated match to d4n14a_

Details for d4bh6g_

PDB Entry: 4bh6 (more details), 2.9 Å

PDB Description: Insights into degron recognition by APC coactivators from the structure of an Acm1-Cdh1 complex
PDB Compounds: (G:) apc/c activator protein cdh1

SCOPe Domain Sequences for d4bh6g_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4bh6g_ b.69.4.0 (G:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
rqiakvpyrvldapsladdfyyslidwsstdvlavalgksifltdnntgdvvhlcdtene
ytslswigagshlavgqanglveiydvmkrkcirtlsghidrvaclswnnhvltsgsrdh
rilhrdvrmpdpffetieshtqevcglkwnvadnklasggndnvvhvyegtskspiltfd
ehkaavkamawsphkrgvlatgggtadrrlkiwnvntsikmsdidsgsqicnmvwskntn
elvtshgyskynltlwdcnsmdpiailkghsfrvlhltlsndgttvvsgagdetlrywkl
fdk

SCOPe Domain Coordinates for d4bh6g_:

Click to download the PDB-style file with coordinates for d4bh6g_.
(The format of our PDB-style files is described here.)

Timeline for d4bh6g_: