SCOPe 2.05: Domain d4bh6b_: 4bh6 B:

Lineage for d4bh6b_ (4bh6 B:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.69: 7-bladed beta-propeller [50964] (14 superfamilies)
   consists of seven 4-stranded beta-sheet motifs; meander

4. Superfamily b.69.4: WD40 repeat-like [50978] (4 families)
   also contains 8-bladed propellers

5. Family b.69.4.0: automated matches [191412] (1 protein)
   not a true family

6. Protein automated matches [190568] (5 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [267834] (2 PDB entries)

8. Domain d4bh6b_: 4bh6 B: [265931]
   automated match to d4n14a_

Details for d4bh6b_

PDB Entry: 4bh6, 2.9 Å

PDB Description: Insights into degron recognition by APC coactivators from the structure of an Acm1-Cdh1 complex

PDB Compounds: (B:) apc/c activator protein cdh1

SCOPe Domain Sequences for d4bh6b_:

Sequence; same for both SEQRES and ATOM records:

>d4bh6b_ b.69.4.0 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
rqiakvpyrvldapsladdfyyslidwsstdvlavalgksifltdnntgdvvhlcdtene
ytslswigagshlavgqanglveiydvmkrkcirtlsghidrvaclswnnhvltsgsrdh
rilhrdvrmpdpffetieshtqevcglkwnvadnklasggndnvvhvyegtskspiltfd
ehkaavkamawsphkrgvlatgggtadrrlkiwnvntsikmsdidsgsqicnmvwskntn
elvtshgyskynltlwdcnsmdpiailkghsfrvlhltlsndgttvvsgagdetlrywkl
fdkp

Timeline for d4bh6b_:

• d4bh6b_ is new in SCOPe 2.05-stable
  
• d4bh6b_ appears in SCOPe 2.06
  
• d4bh6b_ appears in the current release, SCOPe 2.08