![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.22: GFP-like [54510] (1 superfamily) beta-sheet folds into a barrel (n=11, S=14) around the central helix |
![]() | Superfamily d.22.1: GFP-like [54511] (3 families) ![]() |
![]() | Family d.22.1.1: Fluorescent proteins [54512] (6 proteins) |
![]() | Protein automated matches [190406] (19 species) not a true protein |
![]() | Species Jellyfish (Aequorea victoria) [TaxId:6100] [188134] (57 PDB entries) |
![]() | Domain d4bduc1: 4bdu C:2-230 [265925] Other proteins in same PDB: d4bdua2, d4bdub2, d4bduc2, d4bdud2 automated match to d4bdud1 |
PDB Entry: 4bdu (more details), 3 Å
SCOPe Domain Sequences for d4bduc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4bduc1 d.22.1.1 (C:2-230) automated matches {Jellyfish (Aequorea victoria) [TaxId: 6100]} skgeelftgvvpilveldgdvnghkfsvsgegegdatygkltlkficttgklpvpwptlv ttfgygvqcfsrypdhmkqhdffksampegyvqertiffkddgnyktraevkfegdtlvn rielkgidfkedgnilghkleynynshnvyimadkqkngikvnfkirhniedgsvqladh yqqntpigdgpvllpdnhylstqsnlskdpnekrdhmvllefvtaagit
Timeline for d4bduc1: