SCOPe 2.08: Domain d4bdub2: 4bdu B:1054-1122

Lineage for d4bdub2 (4bdu B:1054-1122)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
   multi-helical domains of various folds which is thought to unfold in the membrane

4. Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (2 families)
   PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain

5. Family f.1.4.0: automated matches [195065] (1 protein)
   not a true family

6. Protein automated matches [195066] (5 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225196] (14 PDB entries)

8. Domain d4bdub2: 4bdu B:1054-1122 [265924]
   Other proteins in same PDB: d4bdua1, d4bdub1, d4bduc1, d4bdud1
   automated match to d4bdud2

Details for d4bdub2

PDB Entry: 4bdu, 3 Å

PDB Description: bax bh3-in-groove dimer (gfp)

PDB Compounds: (B:) green fluorescent protein, apoptosis regulator bax

SCOPe Domain Sequences for d4bdub2:

Sequence; same for both SEQRES and ATOM records:

>d4bdub2 f.1.4.0 (B:1054-1122) automated matches {Human (Homo sapiens) [TaxId: 9606]}
astkklseslkrigdeldsnmelqrmiaavdtdsprevffrvaadmfsdgnfnwgrvval
fyfasklvl

Timeline for d4bdub2:

• d4bdub2 first appeared in SCOPe 2.05
  
• d4bdub2 appears in SCOPe 2.07