SCOPe 2.08: Domain d4bdub1: 4bdu B:2-230

Lineage for d4bdub1 (4bdu B:2-230)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.22: GFP-like [54510] (1 superfamily)
   beta-sheet folds into a barrel (n=11, S=14) around the central helix

4. Superfamily d.22.1: GFP-like [54511] (3 families)

5. Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)

6. Protein automated matches [190406] (19 species)
   not a true protein

7. Species Jellyfish (Aequorea victoria) [TaxId:6100] [188134] (57 PDB entries)

8. Domain d4bdub1: 4bdu B:2-230 [265923]
   Other proteins in same PDB: d4bdua2, d4bdub2, d4bduc2, d4bdud2
   automated match to d4bdud1

Details for d4bdub1

PDB Entry: 4bdu, 3 Å

PDB Description: bax bh3-in-groove dimer (gfp)

PDB Compounds: (B:) green fluorescent protein, apoptosis regulator bax

SCOPe Domain Sequences for d4bdub1:

Sequence; same for both SEQRES and ATOM records:

>d4bdub1 d.22.1.1 (B:2-230) automated matches {Jellyfish (Aequorea victoria) [TaxId: 6100]}
skgeelftgvvpilveldgdvnghkfsvsgegegdatygkltlkficttgklpvpwptlv
ttfgygvqcfsrypdhmkqhdffksampegyvqertiffkddgnyktraevkfegdtlvn
rielkgidfkedgnilghkleynynshnvyimadkqkngikvnfkirhniedgsvqladh
yqqntpigdgpvllpdnhylstqsnlskdpnekrdhmvllefvtaagit

Timeline for d4bdub1:

• d4bdub1 first appeared in SCOPe 2.05
  
• d4bdub1 appears in SCOPe 2.07