Lineage for d4bdua2 (4bdu A:1054-1122)

  1. Root: SCOPe 2.05
  2. 1955192Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1955193Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
    multi-helical domains of various folds which is thought to unfold in the membrane
  4. 1955265Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (2 families) (S)
    PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain
  5. 1955513Family f.1.4.0: automated matches [195065] (1 protein)
    not a true family
  6. 1955514Protein automated matches [195066] (3 species)
    not a true protein
  7. 1955531Species Jellyfish (Aequorea victoria) [TaxId:6100] [267921] (1 PDB entry)
  8. 1955532Domain d4bdua2: 4bdu A:1054-1122 [265922]
    Other proteins in same PDB: d4bdua1, d4bdub1, d4bduc1, d4bdud1
    automated match to d4bdud2

Details for d4bdua2

PDB Entry: 4bdu (more details), 3 Å

PDB Description: bax bh3-in-groove dimer (gfp)
PDB Compounds: (A:) green fluorescent protein, apoptosis regulator bax

SCOPe Domain Sequences for d4bdua2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4bdua2 f.1.4.0 (A:1054-1122) automated matches {Jellyfish (Aequorea victoria) [TaxId: 6100]}
astkklseslkrigdeldsnmelqrmiaavdtdsprevffrvaadmfsdgnfnwgrvval
fyfasklvl

SCOPe Domain Coordinates for d4bdua2:

Click to download the PDB-style file with coordinates for d4bdua2.
(The format of our PDB-style files is described here.)

Timeline for d4bdua2: