Lineage for d4baza_ (4baz A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2134062Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2134063Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2136079Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 2136080Protein automated matches [190543] (90 species)
    not a true protein
  7. 2136581Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [189478] (7 PDB entries)
  8. 2136583Domain d4baza_: 4baz A: [265919]
    automated match to d3kdaa_
    complexed with cl, gol, so4; mutant

Details for d4baza_

PDB Entry: 4baz (more details), 1.35 Å

PDB Description: Structure of a putative epoxide hydrolase Q244E mutant from Pseudomonas aeruginosa.
PDB Compounds: (A:) probable epoxide hydrolase

SCOPe Domain Sequences for d4baza_:

Sequence, based on SEQRES records: (download)

>d4baza_ c.69.1.0 (A:) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
tdpllpgfdyltlhtsaarlrvavkgsgppllllhgypqthlawhriaprlaedysvvla
dlrgygesraldeegadyskaalardqletmgqlgferfavighdrgarvgyrlaldhpq
avaafvsltvvpildnwaavnkvfalnayhwfllaqpydlperligadpehfldytlrrm
aqgrdiyhpqalesyrrafrdpavrhamcedyraavgvdadadqadrdagrrlqcpvqvl
weerpyaagqhpleiwktwagqvegaaigashmlpedapdavlehllgflashrealr

Sequence, based on observed residues (ATOM records): (download)

>d4baza_ c.69.1.0 (A:) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
tdpllpgfdyltlhtsaarlrvavkgsgppllllhgypqthlawhriaprlaedysvvla
dlrgygesraldgadyskaalardqletmgqlgferfavighdrgarvgyrlaldhpqav
aafvsltvvpildnwaavnkvfalnayhwfllaqpydlperligadpehfldytlrrmaq
grdiyhpqalesyrrafrdpavrhamcedyraavgvdadadqadrdagrrlqcpvqvlwe
erpyaagqhpleiwktwagqvegaaigashmlpedapdavlehllgflashrealr

SCOPe Domain Coordinates for d4baza_:

Click to download the PDB-style file with coordinates for d4baza_.
(The format of our PDB-style files is described here.)

Timeline for d4baza_: