Lineage for d4baua_ (4bau A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2134062Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2134063Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2136079Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 2136080Protein automated matches [190543] (90 species)
    not a true protein
  7. 2136581Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [189478] (7 PDB entries)
  8. 2136586Domain d4baua_: 4bau A: [265918]
    automated match to d4dm7a_
    complexed with cl, fah, so4; mutant

Details for d4baua_

PDB Entry: 4bau (more details), 1.55 Å

PDB Description: Structure of a putative epoxide hydrolase t131d mutant from Pseudomonas aeruginosa, with bound MFA
PDB Compounds: (A:) probable epoxide hydrolase

SCOPe Domain Sequences for d4baua_:

Sequence, based on SEQRES records: (download)

>d4baua_ c.69.1.0 (A:) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
dpllpgfdyltlhtsaarlrvavkgsgppllllhgypqthlawhriaprlaedysvvlad
lrgygesraldeegadyskaalardqletmgqlgferfavighdrgarvgyrlaldhpqa
vaafvsldvvpildnwaavnkvfalnayhwfllaqpydlperligadpehfldytlrrma
qgrdiyhpqalesyrrafrdpavrhamcedyraavgvdadadqadrdagrrlqcpvqvlw
qerpyaagqhpleiwktwagqvegaaigashmlpedapdavlehllgflashrealr

Sequence, based on observed residues (ATOM records): (download)

>d4baua_ c.69.1.0 (A:) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
dpllpgfdyltlhtsaarlrvavkgsgppllllhgypqthlawhriaprlaedysvvlad
lrgygesraldgadyskaalardqletmgqlgferfavighdrgarvgyrlaldhpqava
afvsldvvpildnwaavnkvfalnayhwfllaqpydlperligadpehfldytlrrmaqg
rdiyhpqalesyrrafrdpavrhamcedyraavgvdadadqadrdagrrlqcpvqvlwqe
rpyaagqhpleiwktwagqvegaaigashmlpedapdavlehllgflashrealr

SCOPe Domain Coordinates for d4baua_:

Click to download the PDB-style file with coordinates for d4baua_.
(The format of our PDB-style files is described here.)

Timeline for d4baua_: