Lineage for d4b9ea_ (4b9e A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2899459Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2899460Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2901917Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 2901918Protein automated matches [190543] (131 species)
    not a true protein
  7. 2902837Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [189478] (7 PDB entries)
  8. 2902840Domain d4b9ea_: 4b9e A: [265916]
    automated match to d3kdaa_
    complexed with fah, gol, so4

Details for d4b9ea_

PDB Entry: 4b9e (more details), 1.4 Å

PDB Description: Structure of a putative epoxide hydrolase from Pseudomonas aeruginosa, with bound MFA.
PDB Compounds: (A:) probable epoxide hydrolase

SCOPe Domain Sequences for d4b9ea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4b9ea_ c.69.1.0 (A:) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
dpllpgfdyltlhtsaarlrvavkgsgppllllhgypqthlawhriaprlaedysvvlad
lrgygesraldeegadyskaalardqletmgqlgferfavighdrgarvgyrlaldhpqa
vaafvsltvvpildnwaavnkvfalnayhwfllaqpydlperligadpehfldytlrrma
qgrdiyhpqalesyrrafrdpavrhamcedyraavgvdadadqadrdagrrlqcpvqvlw
qerpyaagqhpleiwktwagqvegaaigashmlpedapdavlehllgflashrealr

SCOPe Domain Coordinates for d4b9ea_:

Click to download the PDB-style file with coordinates for d4b9ea_.
(The format of our PDB-style files is described here.)

Timeline for d4b9ea_: