Lineage for d4b7sb_ (4b7s B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004931Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2004932Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2005528Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 2005529Protein automated matches [190847] (63 species)
    not a true protein
  7. 2005933Species Streptomyces venezuelae [TaxId:54571] [255065] (14 PDB entries)
  8. 2005942Domain d4b7sb_: 4b7s B: [265914]
    automated match to d4dnja_
    complexed with gol, hem, qle, so4; mutant

Details for d4b7sb_

PDB Entry: 4b7s (more details), 1.84 Å

PDB Description: PikC D50N mutant bound to the 10-DML analog with the 3-(N,N- dimethylamino)propanoate anchoring group
PDB Compounds: (B:) cytochrome p450 hydroxylase pikc

SCOPe Domain Sequences for d4b7sb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4b7sb_ a.104.1.0 (B:) automated matches {Streptomyces venezuelae [TaxId: 54571]}
vldlgalgqdfaadpyptyarlraegpahrvrtpegnevwlvvgydraravladprfskd
wrnsttplteaeaalnhnmlesdpprhtrlrklvareftmrrvellrprvqeivdglvda
mlaapdgradlmeslawplpitvisellgvpepdraafrvwtdafvfpddpaqaqtamae
msgylsrlidskrgqdgedllsalvrtsdedgsrltseellgmahillvaghettvnlia
ngmyallshpdqlaalradmtlldgaveemlryegpvesatyrfpvepvdldgtvipagd
tvlvvladahrtperfpdphrfdirrdtaghlafghgihfcigaplarleariavralle
rcpdlaldvspgelvwypnpmirglkalpirwr

SCOPe Domain Coordinates for d4b7sb_:

Click to download the PDB-style file with coordinates for d4b7sb_.
(The format of our PDB-style files is described here.)

Timeline for d4b7sb_: